PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00537.1.g00070.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 128aa    MW: 14367.7 Da    PI: 12.0839
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00537.1.g00070.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.92.1e-261160251
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  rie+k+ rqv fskRr+g++KKA+EL  LCdaeva+++fs+ gklyeyss
  Zpz_sc00537.1.g00070.1.am.mk 11 RIEDKTSRQVRFSKRRAGLFKKAFELALLCDAEVALVVFSPGGKLYEYSS 60
                                  8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-32261IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.385262IPR002100Transcription factor, MADS-box
CDDcd002652.17E-35363No hitNo description
PRINTSPR004049.8E-27424IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-26466IPR002100Transcription factor, MADS-box
PfamPF003197.4E-261158IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-272439IPR002100Transcription factor, MADS-box
PRINTSPR004049.8E-273960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MARRGPVELR RIEDKTSRQV RFSKRRAGLF KKAFELALLC DAEVALVVFS PGGKLYEYSS  60
TRFARFPSST FRIRRPSALG HRVPCSAGSP WVHGAERLFR LSMGTWLNTR DVAVVGARGS  120
MAPRALWA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D9e-18461259Myocyte-specific enhancer factor 2A
3mu6_C9e-18461259Myocyte-specific enhancer factor 2A
3mu6_B9e-18461259Myocyte-specific enhancer factor 2A
3mu6_A9e-18461259Myocyte-specific enhancer factor 2A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0383496e-70BT038349.1 Zea mays full-length cDNA clone ZM_BFb0228B20 mRNA, complete cds.
GenBankBT0684986e-70BT068498.2 Zea mays full-length cDNA clone ZM_BFb0234P15 mRNA, complete cds.
GenBankEU9519386e-70EU951938.1 Zea mays clone 1063645 mRNA sequence.
GenBankEU9616776e-70EU961677.1 Zea mays clone 237541 MADS-box transcription factor 8 mRNA, complete cds.
GenBankKJ7269346e-70KJ726934.1 Zea mays clone pUT3480 MADS transcription factor (MADS69) mRNA, partial cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.16e-26AGAMOUS-like 14